PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn292671
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 413aa    MW: 44898.8 Da    PI: 7.7759
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn292671genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26069.57.2e-22171081097
      DUF260  10 rkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                 r+C ++C ++p++     p++q++++ +++k++G++ +++l++a p++ r+++++sl+yeA+ r+ +P+yG+vg+++++++ l+q ++e++l 
  Achn292671  17 RQC-DNCSIRPCLqwiksPESQANATVFLAKFYGRAGLINLINAGPDNLRPAIFRSLLYEACGRIVNPIYGSVGLLWSGNWLLCQNAVEAVLN 108
                 556.58*********************************************************************************998875 PP

2DUF26061.13.1e-19155247597
      DUF260   5 CkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                 C+++r + +++       p++q++++ +++k++G++ +++l++a p++ r+++++sl+yeA+ r+ +P+yG+vg+++++++ l+q ++e++l 
  Achn292671 155 CRFKRSAVKPKASQWIKSPESQANATVFLAKFYGRAGLINLINAGPDNLRPAIFRSLLYEACGRIVNPIYGSVGLLWSGNWLLCQNAVEAVLN 247
                 66666666666555445599*******************************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.773112IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-1617105IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089111.213150251IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-14155244IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MEAAGGCDRG VRMSCGRQCD NCSIRPCLQW IKSPESQANA TVFLAKFYGR AGLINLINAG  60
PDNLRPAIFR SLLYEACGRI VNPIYGSVGL LWSGNWLLCQ NAVEAVLNGV PIIQIGSEAA  120
ECDNGPPLKA YDIRHVSKED NPAGSKDLHR VRTRCRFKRS AVKPKASQWI KSPESQANAT  180
VFLAKFYGRA GLINLINAGP DNLRPAIFRS LLYEACGRIV NPIYGSVGLL WSGNWLLCQN  240
AVEAVLNGVP IIQIGSEAAE CDNGPPLKAY DIRHVSKEDN PAGSKDLHRV RTRCRFKRSA  300
VKPKASQVWS DPVEDSGHDE SNRSTSHESS LSHQSEMVVA AEEKLNVEGE SRELESVPKP  360
NETADNGEIE LELTLGLDPS SRSHNASPKR KSTGRLGDSF DDGACRIELG LP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099556.11e-105PREDICTED: LOB domain-containing protein 41
SwissprotQ9M8864e-81LBD41_ARATH; LOB domain-containing protein 41
TrEMBLM5WTB81e-96M5WTB8_PRUPE; Uncharacterized protein
STRINGPGSC0003DMT4000329382e-89(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8862494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.12e-75LOB domain-containing protein 41